PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA46G00175
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family bZIP
Protein Properties Length: 305aa    MW: 34525.6 Da    PI: 8.4537
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA46G00175genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.61.8e-10214267457
                 XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                  k+ +r+++NRe+A+rsR RK+++ie L+e+v  +  eN++  ++l  l  +++
  AA46G00175 214 EKKRKRMESNRESAKRSRMRKQKQIEDLREEVNRIGLENREISNRLRILLYQIE 267
                 5899***********************************988877766655555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.6E-12211275IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.852213276IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.1E-8213268No hitNo description
PfamPF001701.3E-8215267IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.04E-9215265No hitNo description
CDDcd147023.20E-16216263No hitNo description
PROSITE patternPS000360218233IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MLSTVPAFSF TEPVLVNQFI DFQTGFTPTD LDWIQSFFEP VVPSLYSGES NTGSVRFNTG  60
LQNIKSGSDE SNSGSDDSTC LLSLPNSSSD EFKPNSIKIN SGLQNIKPGS EESYTGSIKL  120
NSGSDDSTCL LSLPNSYSHE FKTNFIKINS GLQTMKSGSD ESCARSHNSG YFAGVSSPQS  180
IELDSEFTKL VKTGSNSFNN RKGLNRPVMK ITDEKKRKRM ESNRESAKRS RMRKQKQIED  240
LREEVNRIGL ENREISNRLR ILLYQIEQVS RVNHQLLSEQ EILRRKLSEM RQILILRELQ  300
IQQQW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1227232KRSRMR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006404751.11e-80hypothetical protein EUTSA_v10000309mg
TrEMBLV4LQX52e-80V4LQX5_EUTSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78551840
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37730.14e-54basic leucine-zipper 7